Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL139C  from Saccharomyces cerevisiae S288C
>YOL139C|YOL139C CDC33 SGDID:S000005499, Chr XV from 61024-60383, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytoplasmic mRNA cap binding protein and translation initiation factor eIF4E; the eIF4E-cap complex is responsible for mediating cap-dependent mRNA translation via interactions with translation initiation factor eIF4G (Tif4631p or Tif4632p)" ORGANISM: Saccharomyces cerevisiae S288C (213 aa)
MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSD
LLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLR
GKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSEDKEPLLRIGG
KFKQVLKLTDDGHLEFFPHSSANGRHPQPSITL