Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL127W  from Saccharomyces cerevisiae S288C
>YOL127W|YOL127W RPL25 SGDID:S000005487, Chr XV from 80348-80360,80775-81190, Genome Release 64-1-1, Verified ORF, "Primary rRNA-binding ribosomal protein component of the large (60S) ribosomal subunit, has similarity to E. coli L23 and rat L23a ribosomal proteins; binds to 25S rRNA via a conserved C-terminal motif" ORGANISM: Saccharomyces cerevisiae S288C (142 aa)
MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSY
KVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTK
KAYVRLTADYDALDIANRIGYI