Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL121C  from Saccharomyces cerevisiae S288C
>YOL121C|YOL121C RPS19A SGDID:S000005481, Chr XV from 92440-92026,92850-92831, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit, required for assembly and maturation of pre-40 S particles; mutations in human RPS19 are associated with Diamond Blackfan anemia; nearly identical to Rps19Bp" ORGANISM: Saccharomyces cerevisiae S288C (144 aa)
MPGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAEGWFYKRAAS
VARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSINRKVLQALEKIGIVEISPKG
GRRISENGQRDLDRIAAQTLEEDE