Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL109W  from Saccharomyces cerevisiae S288C
>YOL109W|YOL109W ZEO1 SGDID:S000005469, Chr XV from 110297-110638, Genome Release 64-1-1, Verified ORF, "Peripheral membrane protein of the plasma membrane that interacts with Mid2p; regulates the cell integrity pathway mediated by Pkc1p and Slt2p; the authentic protein is detected in a phosphorylated state in highly purified mitochondria" ORGANISM: Saccharomyces cerevisiae S288C (113 aa)
MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKNEATPEAEQVKKEEQ
NIADGVEQKKTEAANKVEETKKQASAAVSEKKETKKEGGFLKKLNRKIASIFN