Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL108C  from Saccharomyces cerevisiae S288C
>YOL108C|YOL108C INO4 SGDID:S000005468, Chr XV from 111886-111431, Genome Release 64-1-1, reverse complement, Verified ORF, "Transcription factor required for derepression of inositol-choline-regulated genes involved in phospholipid synthesis; forms a complex, with Ino2p, that binds the inositol-choline-responsive element through a basic helix-loop-helix domain" ORGANISM: Saccharomyces cerevisiae S288C (151 aa)
MTNDIKEIQTIQPGLSEIKEIKGELANVKKRKRRSKKINKLTDGQIRINHVSSEKKRREL
ERAIFDELVAVVPDLQPQESRSELIIYLKSLSYLSWLYERNEKLRKQIIAKHEAKTGSSS
SSDPVQEQNGNIRDLVPKELIWELGDGQSGQ