Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL102C  from Saccharomyces cerevisiae S288C
>YOL102C|YOL102C TPT1 SGDID:S000005462, Chr XV from 126689-125997, Genome Release 64-1-1, reverse complement, Verified ORF, "tRNA 2'-phosphotransferase, catalyzes the final step in yeast tRNA splicing: the transfer of the 2'-PO(4) from the splice junction to NAD(+) to form ADP-ribose 1''-2''cyclic phosphate and nicotinamide" ORGANISM: Saccharomyces cerevisiae S288C (230 aa)
MRQVLQKDKRDVQLSKALSYLLRHTAVKEKLTIDSNGYTPLKELLSHNRLKTHKCTVDDI
HRIVKENDKQRFHIKTLGADEEWICATQGHSIKSIQPSDEVLVPITEASQLPQELIHGTN
LQSVIKIIESGAISPMSRNHVHLSPGMLHAKGVISGMRSSSNVYIFIDCHSPLFFQTLKM
FRSLNNVYLSSSIPVELIQKVVVKGNLKDEEKLDTLRRILHERNIPLEKI