Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOL086W-A  from Saccharomyces cerevisiae S288C
>YOL086W-A|YOL086W-A YOL086W-A SGDID:S000007626, Chr XV from 159173-159445, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; mutant in a srs2 mutant background displays MMS hypersensitivity; ortholog of human MHF1, a component of the Fanconi anemia (FA) complex that is involved in maintaining genome stability" ORGANISM: Saccharomyces cerevisiae S288C (90 aa)
MNDDEDRAQLKARLWIRVEERLQQVLSSEDIKYTPRFINSLLELAYLQLGEMGSDLQAFA
RHAGRGVVNKSDLMLYLRKQPDLQERVTQE