Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL077W-A  from Saccharomyces cerevisiae S288C
>YOL077W-A|YOL077W-A ATP19 SGDID:S000007339, Chr XV from 185438-185644, Genome Release 64-1-1, Verified ORF, "Subunit k of the mitochondrial F1F0 ATP synthase, which is a large enzyme complex required for ATP synthesis; associated only with the dimeric form of ATP synthase" ORGANISM: Saccharomyces cerevisiae S288C (68 aa)
MGAAYHFMGKAIPPHQLAIGTLGLLGLLVVPNPFKSAKPKTVDIKTDNKDEEKFIENYLK
KHSEKQDA