Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL071W  from Saccharomyces cerevisiae S288C
>YOL071W|YOL071W EMI5 SGDID:S000005432, Chr XV from 196507-196995, Genome Release 64-1-1, Verified ORF, "Subunit of succinate dehydrogenase, which couples succinate oxidation to ubiquinone reduction; required for FAD cofactor attachment to Sdh1p; mutations in human ortholog PGL2 are associated with neuroendocrine tumors (paraganglioma)" ORGANISM: Saccharomyces cerevisiae S288C (162 aa)
MHNMFPALTKTLSLQGYKIINSQTGSAAWSCGRRWFSSDKDDHDDVVTRIKIAPIKRTNE
PLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWAT
KNFKTSPLPDKWANSKLLKQLQEFSENKEKEILSMPDLSKYQ