Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL067C  from Saccharomyces cerevisiae S288C
>YOL067C|YOL067C RTG1 SGDID:S000005428, Chr XV from 202518-201985, Genome Release 64-1-1, reverse complement, Verified ORF, "Transcription factor (bHLH) involved in interorganelle communication between mitochondria, peroxisomes, and nucleus" ORGANISM: Saccharomyces cerevisiae S288C (177 aa)
MSSIPAGTDPGSCGANFKNDRKRRDKINDRIQELLSIIPKDFFRDYYGNSGSNDTLSEST
PGALGLSSKAKGTGTKDGKPNKGQILTQAVEYISHLQNQVDTQNREEVELMVKATQLAKQ
TGTIVNDINLENTSAEVALSRIGVGPLAATNDDSVRPPAKRLSSFEYGGYGEYGNGS