Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL052C-A  from Saccharomyces cerevisiae S288C
>YOL052C-A|YOL052C-A DDR2 SGDID:S000005413, Chr XV from 231755-231570, Genome Release 64-1-1, reverse complement, Verified ORF, "Multistress response protein, expression is activated by a variety of xenobiotic agents and environmental or physiological stresses" ORGANISM: Saccharomyces cerevisiae S288C (61 aa)
MKVSQVFISAISVFGLATSVNAQNASNTTSNAAPALHAQNGQLLNAGVVGAAVGGALAFL
I