Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL039W  from Saccharomyces cerevisiae S288C
>YOL039W|YOL039W RPP2A SGDID:S000005399, Chr XV from 254297-254617, Genome Release 64-1-1, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" ORGANISM: Saccharomyces cerevisiae S288C (106 aa)
MKYLAAYLLLNAAGNTPDATKIKAILESVGIEIEDEKVSSVLSALEGKSVDELITEGNEK
LAAVPAAGPASAGGAAAASGDAAAEEEKEEEAAEESDDDMGFGLFD