Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOL038C-A  from Saccharomyces cerevisiae S288C
>YOL038C-A|YOL038C-A YOL038C-A SGDID:S000028812, Chr XV from 255021-254926, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by SAGE analysis" ORGANISM: Saccharomyces cerevisiae S288C (31 aa)
MKYMGSFLRKAATTNLFNSIKKRKVQNRAMS