Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL026C  from Saccharomyces cerevisiae S288C
>YOL026C|YOL026C MIM1 SGDID:S000005386, Chr XV from 274353-274012, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial outer membrane protein, involved in the insertion of TOM (translocase of outer membrane) complex components into the membrane and required for assembly of the TOM complex; mutants display impaired mitochondrial protein import" ORGANISM: Saccharomyces cerevisiae S288C (113 aa)
MTEVVGFWESVSDDESEDKDCMEVQNTVSADESPLVQSLVSFVGSCSINLLLPFLNGMML
GFGELFAHELCWRFNWFNHRNKGYKVYPESRKIAALKEISSPGTRGRVASKFL