Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOL019W-A  from Saccharomyces cerevisiae S288C
>YOL019W-A|YOL019W-A YOL019W-A SGDID:S000028707, Chr XV from 288420-288572, Genome Release 64-1-1, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (50 aa)
MSNTFVAVEFSWLYAISLILPCETIRVAWAPKRAYHGTSEEKRRLAPADI