Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL013W-A  from Saccharomyces cerevisiae S288C
>YOL013W-A|YOL013W-A YOL013W-A SGDID:S000028811, Chr XV from 301047-301238, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by SAGE" ORGANISM: Saccharomyces cerevisiae S288C (63 aa)
MMCIINSESFHGSQKRSGVWSSGMILALGDFLINRGTKHARGPGFNSQLAPFFTIEKYSV
RRS