Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOL012C  from Saccharomyces cerevisiae S288C
>YOL012C|YOL012C HTZ1 SGDID:S000005372, Chr XV from 303983-303579, Genome Release 64-1-1, reverse complement, Verified ORF, "Histone variant H2AZ, exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin" ORGANISM: Saccharomyces cerevisiae S288C (134 aa)
MSGKAHGGKGKSGAKDSGSLRSQSSSARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYL
TAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHIN
KALLLKVEKKGSKK