Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YNR077C  from Saccharomyces cerevisiae S288C
>YNR077C|YNR077C YNR077C SGDID:S000005360, Chr XIV from 783541-783287, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function, abundance changes with carbon source" ORGANISM: Saccharomyces cerevisiae S288C (84 aa)
MHGTCLSGLYPEPFTHNSHDYPHFNIYISFGGPKYCITALNTYVIPLLHHILTTQFIHTY
FNIPTKSPPKSPKHKNYLSFNFTK