Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNR076W  from Saccharomyces cerevisiae S288C
>YNR076W|YNR076W PAU6 SGDID:S000005359, Chr XIV from 781918-782280, Genome Release 64-1-1, Verified ORF, "Member of the seripauperin multigene family encoded mainly in subtelomeric regions, active during alcoholic fermentation, regulated by anaerobiosis, negatively regulated by oxygen, repressed by heme; identical to Pau18p" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTE
TYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSTRLKPAISKALSKDGIYTIAN