Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YNR075C-A  from Saccharomyces cerevisiae S288C
>YNR075C-A|YNR075C-A YNR075C-A SGDID:S000028706, Chr XIV from 781603-781511, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (30 aa)
MPIIGVPRCLENPFCAPAKFPLSVKKKIRI