Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNR049C  from Saccharomyces cerevisiae S288C
>YNR049C|YNR049C MSO1 SGDID:S000005332, Chr XIV from 713655-713023, Genome Release 64-1-1, reverse complement, Verified ORF, "Probable component of the secretory vesicle docking complex, acts at a late step in secretion; shows genetic and physical interactions with Sec1p; required for prospore membrane formation during sporulation" ORGANISM: Saccharomyces cerevisiae S288C (210 aa)
MMSQVSHSQEGSGRFWNKFKSSTKSLSTSLAHLSIKAEKDGDTVNTTLVHKGLVKFYENQ
HPFQGFPGWLGEKEDLPNERKILDTQVKHDMKKQNSRHFSPSFSNRRKASSEDPMGTPSS
NGNTPEYTPASKSFQDIYNNHTSSSSATPRRASSRPTRPSAGQEFRASLGRSKTSNSFNT
SSTPTPPPDASSGVMAMKDRLKRRNNDYGF