Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNR046W  from Saccharomyces cerevisiae S288C
>YNR046W|YNR046W TRM112 SGDID:S000005329, Chr XIV from 707788-708195, Genome Release 64-1-1, Verified ORF, "Subunit of tRNA methyltransferase (MTase) complexes in combination with Trm9p and Trm11p; subunit of complex with Mtq2p that methylates Sup45p (eRF1) in the ternary complex eRF1-eRF3-GTP; deletion confers resistance to zymocin" ORGANISM: Saccharomyces cerevisiae S288C (135 aa)
MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVL
TVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYY
IKNGIPNLLLPPHLV