Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNR037C  from Saccharomyces cerevisiae S288C
>YNR037C|YNR037C RSM19 SGDID:S000005320, Chr XIV from 695327-695052, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the small subunit, has similarity to E. coli S19 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (91 aa)
MQPAARLLSRSVWKGPNIVPLPIREAMTKGTPIRTNARAATILPQFVGLKFQIHNGKEYV
PIEISEDMVGHKLGEFAPTRKRFSYTQTKNK