Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNR036C  from Saccharomyces cerevisiae S288C
>YNR036C|YNR036C MRPS12 SGDID:S000005319, Chr XIV from 694822-694361, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial protein; may interact with ribosomes based on co-purification experiments; similar to E. coli and human mitochondrial S12 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (153 aa)
MLSRFMSNTWCTPLRQAQRLFSSTTTMQATLNQIKRGSGPPRRKKISTAPQLDQCPQRKG
VVLRVMVLKPKKPNSAQRKACRVRLTNGNVVSAYIPGEGHDAQEHSIVYVRGGRCQDLPG
VKYHVIRGAGDLSGVVNRISSRSKYGAKKPSKS