>YNR032C-A|YNR032C-A HUB1 SGDID:S000007251, Chr XIV from 687464-687243, Genome Release 64-1-1, reverse complement, Verified ORF, "Ubiquitin-like protein modifier; promotes alternative splicing of SRC1 pre-mRNA; binds non-covalently to the HIND domain of Snu66, may function in modification of Sph1p and Hbt1p, functionally complemented by the human or S. pombe ortholog; mechanism of Hub1p adduct formation not yet clear" ORGANISM: Saccharomyces cerevisiae S288C (73 aa)
MIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDY
EVHDQTNLELYYL