Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNR017W  from Saccharomyces cerevisiae S288C
>YNR017W|YNR017W TIM23 SGDID:S000005300, Chr XIV from 662913-663581, Genome Release 64-1-1, Verified ORF, "Essential component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex); involved in protein import into mitochondrial matrix and inner membrane; with Tim17p, contributes to architecture and function of the import channel" ORGANISM: Saccharomyces cerevisiae S288C (222 aa)
MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP
LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG
LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG
AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK