Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNR010W  from Saccharomyces cerevisiae S288C
>YNR010W|YNR010W CSE2 SGDID:S000005293, Chr XIV from 643744-644193, Genome Release 64-1-1, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; component of the Middle domain of mediator; required for regulation of RNA polymerase II activity" ORGANISM: Saccharomyces cerevisiae S288C (149 aa)
MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTS
SNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPS
EWQDIIHQREQELQIKRDVLDDLYRKLQR