Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNR004W  from Saccharomyces cerevisiae S288C
>YNR004W|YNR004W SWM2 SGDID:S000005287, Chr XIV from 635943-636383, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; haploid disruptant exhibits cold-sensitive growth and elongated buds" ORGANISM: Saccharomyces cerevisiae S288C (146 aa)
MIDLYNYSNLEGLLDGLTDLNRIPKEYSAVLEPYFQNIARNAHLKSRALKICRSNFHKWN
EEGAKTVNPEIIRRCLNLWYVLKGKEYKKLKDPPPADNIIKDEIDVSYVKNLNVVRLEFD
EFGKLISNPLENLILEEVEVNDFIQE