Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL328C  from Saccharomyces cerevisiae S288C
>YNL328C|YNL328C MDJ2 SGDID:S000005272, Chr XIV from 23274-22834, Genome Release 64-1-1, reverse complement, Verified ORF, "Constituent of the mitochondrial import motor associated with the presequence translocase; function overlaps with that of Pam18p; stimulates the ATPase activity of Ssc1p to drive mitochondrial import; contains a J domain" ORGANISM: Saccharomyces cerevisiae S288C (146 aa)
MVLPIIIGLGVTMVALSVKSGLNAWTVYKTLSPLTIAKLNNIRIENPTAGYRDALKFKSS
LIDEELKNRLNQYQGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDR
GGSPYMAAKINEAKEVLERSVLLRKR