Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL310C  from Saccharomyces cerevisiae S288C
>YNL310C|YNL310C ZIM17 SGDID:S000005254, Chr XIV from 52431-51907, Genome Release 64-1-1, reverse complement, Verified ORF, "Heat shock protein with a zinc finger motif; essential for protein import into mitochondria; may act with Pam18p to facilitate recognition and folding of imported proteins by Ssc1p (mtHSP70) in the mitochondrial matrix" ORGANISM: Saccharomyces cerevisiae S288C (174 aa)
MIPRTRTLLQSKIPITRYFARCWAPRVRYNVCRTLPAAALHTNIIAHNEVKKDDKKVHLG
SFKVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHH
VTVEQLMKANGEQVSQDVGDLEFEDIPDSLKDVLGKYAKNNSENASQLPHPSQK