Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL305C  from Saccharomyces cerevisiae S288C
>YNL305C|YNL305C BXI1 SGDID:S000005249, Chr XIV from 59791-58898, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in apoptosis; variously described as containing a BCL-2 homology (BH3) domain or as a member of the BAX inhibitor family; reported to promote apoptosis under some conditions and to inhibit it in others; localizes to ER and vacuole; may link the unfolded protein response to apoptosis via regulation of calcium-mediated signaling; translocates to mitochondria under apoptosis-inducing conditions in a process involving Mir1p and Cor1p" ORGANISM: Saccharomyces cerevisiae S288C (297 aa)
MSGPPPPYEEQSSHLYGQPASSQDGNAFIPEDFKYSTVVISCEPIIRQRFMHKVYSLLSC
QLLASLSFCYWASVSTSLQNFIMSHIALFYICMVVSLVSCIWLAVSPRPEDYEASVPEPL
LTGSSEEPAQEQRRLPWYVLSSYKQKLTLLSIFTLSEAYCLSLVTLAYDKDTVLSALLIT
TIVVVGVSLTALSERFENVLNSATSIYYWLNWGLWIMIGMGLTALLFGWNTHSSKFNLLY
GWLGAILFTAYLFIDTQLIFRKVYPDEEVRCAMMLYLDIVNLFLSILRILANSNDDN