Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL302C  from Saccharomyces cerevisiae S288C
>YNL302C|YNL302C RPS19B SGDID:S000005246, Chr XIV from 62372-61958,62943-62924, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit, required for assembly and maturation of pre-40 S particles; mutations in human RPS19 are associated with Diamond Blackfan anemia; nearly identical to Rps19Ap" ORGANISM: Saccharomyces cerevisiae S288C (144 aa)
MAGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAEGWFYKRAAS
VARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSINRKVLQALEKIGIVEISPKG
GRRISENGQRDLDRIAAQTLEEDE