Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL269W  from Saccharomyces cerevisiae S288C
>YNL269W|YNL269W BSC4 SGDID:S000005213, Chr XIV from 137699-138094, Genome Release 64-1-1, Verified ORF, "Protein of unknown function, ORF exhibits genomic organization compatible with a translational readthrough-dependent mode of expression; readthrough is increased upon depletion of Sup35p" ORGANISM: Saccharomyces cerevisiae S288C (131 aa)
MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCLQVVFRKDMVT
KKTTFAQLITRLNHFLCQALKRRDSKTYILCRTAVFGAMTPFSPRKSHINNKLPMQPRKK
KIVIIYVVRFH