Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL260C  from Saccharomyces cerevisiae S288C
>YNL260C|YNL260C YNL260C SGDID:S000005204, Chr XIV from 157455-156859, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function with similarity to a human protein overexpressed in oral cancers; essential gene with defects in anaerobic and filamentous growth; localizes to the nucleus and cytoplasm" ORGANISM: Saccharomyces cerevisiae S288C (198 aa)
MVRNRFIRKMKKNLFKSNHLSYLKSKWKVKITGQIKMDFDNLLNLEEQYYQEGFLEGQNE
NIKQSFLEGKQYGLQVGFQRFTLLGQMEGLCDVIESYGLHSPTLEKNIHTIRTLMKGLKM
NNDDESVMEFERVLIKLKNKFRTILITLHRLVKDKRTPTVTFEVFEDVSRAIAGEIRGFV
ENEDIAKNKTKQNQAQSW