Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL259C  from Saccharomyces cerevisiae S288C
>YNL259C|YNL259C ATX1 SGDID:S000005203, Chr XIV from 157865-157644, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytosolic copper metallochaperone that transports copper to the secretory vesicle copper transporter Ccc2p for eventual insertion into Fet3p, which is a multicopper oxidase required for high-affinity iron uptake" ORGANISM: Saccharomyces cerevisiae S288C (73 aa)
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKI
KKTGKEVRSGKQL