Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL255C  from Saccharomyces cerevisiae S288C
>YNL255C|YNL255C GIS2 SGDID:S000005199, Chr XIV from 167790-167329, Genome Release 64-1-1, reverse complement, Verified ORF, "Translational activator for mRNAs with internal ribosome entry sites; associates with polysomes and binds to a specific subset of mRNAs; ortholog of human ZNF9/CNBP, a gene involved in myotonic dystrophy type 2" ORGANISM: Saccharomyces cerevisiae S288C (153 aa)
MSQKACYVCGKIGHLAEDCDSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRS
ECTVQRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYT
CGQAGHMSRDCQNDRLCYNCNETGHISKDCPKA