Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL245C  from Saccharomyces cerevisiae S288C
>YNL245C|YNL245C CWC25 SGDID:S000005189, Chr XIV from 186885-186346, Genome Release 64-1-1, reverse complement, Verified ORF, "Splicing factor required for the first step of pre-mRNA splicing; binding to the spliceosome requires Prp2p and Yju2p; heat-stable protein; has similarity to S. pombe Cwf25p" ORGANISM: Saccharomyces cerevisiae S288C (179 aa)
MGSGDLNLLKSWNPKLMKNRKKVWETEQDLITEQQKLNTRLKEIEKERELNELLNESSKD
KPETLKNDLALKKSGLEWMYQDAKLSDEKEDYLLGKKKLDSSILNQPATPPVRAATTISA
SGAATSISSQKKKSKLLKDDPMSKFKVTKQQRRTPDSTKKRAMSQRGKPLSKPAPDLDY