Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL244C  from Saccharomyces cerevisiae S288C
>YNL244C|YNL244C SUI1 SGDID:S000005188, Chr XIV from 187496-187170, Genome Release 64-1-1, reverse complement, Verified ORF, "Translation initiation factor eIF1; component of a complex involved in recognition of the initiator codon; modulates translation accuracy at the initiation phase" ORGANISM: Saccharomyces cerevisiae S288C (108 aa)
MSIENLKSFDPFADTGDDETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKK
DFACNGNIVKDPEMGEIIQLQGDQRAKVCEFMISQLGLQKKNIKIHGF