Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL213C  from Saccharomyces cerevisiae S288C
>YNL213C|YNL213C RRG9 SGDID:S000005157, Chr XIV from 247104-246460, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function; null mutant lacks mitochondrial DNA and cannot grow on glycerol; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (214 aa)
MNILRIACRSFHCLRCGPLLNENRGWSSKKIIKLVNKSSLSNKEFTEKVRDGTKDIPEWK
KQKMAVRKKLQGQRWNPPKKISQEQMEALRLLKFNFPELTASDLADRFKISPEAVRRILK
SNWKRTDEENNNTYERWKRRGERIKEMYQRKEDADFVSNQIVTSRKIILGSNSNSPELIA
RNVRTFKPFKPNNSTPEKKNTNKLYILKHLGSKQ