Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL208W  from Saccharomyces cerevisiae S288C
>YNL208W|YNL208W YNL208W SGDID:S000005152, Chr XIV from 254418-255017, Genome Release 64-1-1, Verified ORF, "Protein of unknown function; may interact with ribosomes, based on co-purification experiments; authentic, non-tagged protein is detected in purified mitochondria in high-throughput studies; potential orthologs found in other fungi" ORGANISM: Saccharomyces cerevisiae S288C (199 aa)
MSANEFYSSGQQGQYNQQNNQERTGAPNNGQYGADNGNPNGERGLFSTIVGGSAGAYAGS
KVSNNHSKLSGVLGAIGGAFLANKISDERKEHKQQEQYGNSNFGGAPQGGHNNHHRQDNN
NNNGGFGGPGGPGGQGFGRQGPQGFGGPGPQEFGGPGGQGFGGPNPQEFGGPGGQGFGGP
NPQEFGGQGRQGFNGGSRW