Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL162W  from Saccharomyces cerevisiae S288C
>YNL162W|YNL162W RPL42A SGDID:S000005106, Chr XIV from 331322-331325,331838-332154, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl42Bp and has similarity to rat L44 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (106 aa)
MVNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFGGQTKPVFHK
KAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKGQALQF