Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL158W  from Saccharomyces cerevisiae S288C
>YNL158W|YNL158W PGA1 SGDID:S000005102, Chr XIV from 339612-340208, Genome Release 64-1-1, Verified ORF, "Essential component of GPI-mannosyltransferase II, responsible for second mannose addition to GPI precursors as a partner of Gpi18p; required for maturation of Gas1p and Pho8p; has synthetic genetic interations with secretory pathway genes" ORGANISM: Saccharomyces cerevisiae S288C (198 aa)
MVRPQNVHWFIATIVFFIGFVHANTESILYKVPHNFPLKKPRDSSTYARDVNLISSISLS
GEAMSQITIEANTTDLELHNTTYIELADLQRDETYQIKVCWSAIHPISINNLQTITIPRF
TEFQGTKSDYARILVTFQVLSDSYPSEHAMVPIQVSLITTRLGIPVDIYPTLIVMVLLVA
GLVVTRAPHVLNDLLLKF