Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL157W  from Saccharomyces cerevisiae S288C
>YNL157W|YNL157W IGO1 SGDID:S000005101, Chr XIV from 340352-340858, Genome Release 64-1-1, Verified ORF, "Protein required for initiation of G0 program; prevents degradation of nutrient-regulated mRNAs via the 5'-3' mRNA decay pathway; phosphorylated by Rim15p; GFP protein localizes to the cytoplasm and nucleus; similar to Igo2p" ORGANISM: Saccharomyces cerevisiae S288C (168 aa)
MSNENLSPNSSNPDLTKLNNGESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRK
YFDSGDYALQKAGIQNNDPINYGKNNLPLTNPSKLREDIIKRRISTCPSTASTAGVVDNA
TLIQKEGSISSGPPSSNNGTIGGGSTSSTPVGNHSSSSSSLYTESPIR