Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL153C  from Saccharomyces cerevisiae S288C
>YNL153C|YNL153C GIM3 SGDID:S000005097, Chr XIV from 346058-345669, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it" ORGANISM: Saccharomyces cerevisiae S288C (129 aa)
MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELID
EDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYAK
FGDNINLER