Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL149C  from Saccharomyces cerevisiae S288C
>YNL149C|YNL149C PGA2 SGDID:S000005093, Chr XIV from 349756-349367, Genome Release 64-1-1, reverse complement, Verified ORF, "Essential protein required for maturation of Gas1p and Pho8p; involved in protein trafficking; GFP-fusion protein localizes to the ER and YFP-fusion protein to the nuclear envelope-ER network; null mutants have a cell separation defect" ORGANISM: Saccharomyces cerevisiae S288C (129 aa)
MSEVAETWVDTWMAKLVNYDYKHFIRLVIIVGGYLLLRNIASRELAKKQLAAQVEKDKRD
KEEKRSKDLIDKPDDAATAETTSFGWGKKTRRRVKRQQELFENALEEAKRRNQGLDPDSD
ADIEELLEE