Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL146W  from Saccharomyces cerevisiae S288C
>YNL146W|YNL146W YNL146W SGDID:S000005090, Chr XIV from 351715-352017, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the endoplasmic reticulum; YNL146W is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (100 aa)
MSNTKHTTSHHMELKRIIILTLLFILIMLIFRNSVSFKMTFQELLPRFYKKNSNSVSNNN
RPSSIFSENLVDFDDVNMVDKTRLFIFLFFSFIITIPFMV