Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YNL146C-A  from Saccharomyces cerevisiae S288C
>YNL146C-A|YNL146C-A YNL146C-A SGDID:S000028851, Chr XIV from 351580-351386, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (64 aa)
MISVCFVFPHSLALDFKSRCKKNRTKLCSAYYVSQVLRICKEMPYRDLILFSTVRKGVYM
RLYY