Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL145W  from Saccharomyces cerevisiae S288C
>YNL145W|YNL145W MFA2 SGDID:S000005089, Chr XIV from 352414-352530, Genome Release 64-1-1, Verified ORF, "Mating pheromone a-factor, made by a cells; interacts with alpha cells to induce cell cycle arrest and other responses leading to mating; biogenesis involves C-terminal modification, N-terminal proteolysis, and export; also encoded by MFA1" ORGANISM: Saccharomyces cerevisiae S288C (38 aa)
MQPITTASTQATQKDKSSEKKDNYIIKGLFWDPACVIA