Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL138W-A  from Saccharomyces cerevisiae S288C
>YNL138W-A|YNL138W-A YSF3 SGDID:S000028509, Chr XIV from 366033-366035,366158-366412, Genome Release 64-1-1, Verified ORF, "Component of the SF3b subcomplex of the U2 snRNP, essential protein required for for splicing and for assembly of SF3b" ORGANISM: Saccharomyces cerevisiae S288C (85 aa)
MAEKQRQLKLQKIYKQKYIGLGDESTTREQWQRNVRNDTLNTLQGHSASLEYVSLSRGDL
SIRDTRIHLLKSMSPGYKAYLREER