Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YNL135C  from Saccharomyces cerevisiae S288C
>YNL135C|YNL135C FPR1 SGDID:S000005079, Chr XIV from 372226-371882, Genome Release 64-1-1, reverse complement, Verified ORF, "Peptidyl-prolyl cis-trans isomerase (PPIase), binds to the drugs FK506 and rapamycin; also binds to the nonhistone chromatin binding protein Hmo1p and may regulate its assembly or function" ORGANISM: Saccharomyces cerevisiae S288C (114 aa)
MSEVIEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVG
QVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKVN